PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537145.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 357aa    MW: 39120.4 Da    PI: 9.8442
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537145.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81e-12102146147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g ++t  q++s+ qky
   XP_010537145.1 102 RESWTEPEHDKFLEALQLFDRD-WKKIEAFIG-TKTVIQIRSHAQKY 146
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.68E-1696152IPR009057Homeodomain-like
PROSITE profilePS5129414.09297151IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.7E-6100152IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-18100149IPR006447Myb domain, plants
SMARTSM007175.6E-10101149IPR001005SANT/Myb domain
PfamPF002491.6E-10102146IPR001005SANT/Myb domain
CDDcd001677.94E-8104147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MCPKPRFEFF VCQRLKLKTN RPKPEDPLIL VAEFMVSRNA NLGGGFYLDP TGMTLPGLGP  60
FSGAAATTTS SGVAAATAMV SSSSEEDPGK KVRKPYTITK SRESWTEPEH DKFLEALQLF  120
DRDWKKIEAF IGTKTVIQIR SHAQKYFLKA QKSGGGEHLP PPRPKRKAAH PYPQKAPKNA  180
QPQVLGSFKS SEPGHLFRPE SSSMPMNSAN AAGVPVWTNT VQTISFSPIP KAGPGATNNC  240
SSSSENAPRT RPRGDTSEQG SHGHSLRVLP DFAQVYNFIG SVFDPYATDH RQKLKKMDPI  300
DVETVMLLMR NLAINLASPD FEDHRRLLPC YDIGSDTTDH GGGASKTLNK EKPEIST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00560DAPTransfer from AT5G52660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010537145.10.0PREDICTED: protein REVEILLE 6-like isoform X1
SwissprotQ8H0W31e-161RVE6_ARATH; Protein REVEILLE 6
TrEMBLR0GMQ91e-158R0GMQ9_9BRAS; Uncharacterized protein (Fragment)
STRINGAT5G52660.21e-158(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-135MYB_related family protein